PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G033000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 425aa    MW: 47142.7 Da    PI: 6.8729
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G033000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.3e-181461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l + ++++G g+W+t+++  g+ R++k+c++rw +yl
  Sevir.5G033000.1.p 14 KGLWSPEEDEKLMNHITKHGHGCWSTVPKLAGLQRCGKSCRLRWINYL 61
                        678*******************************************97 PP

2Myb_DNA-binding47.15.5e-1567109145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         rg++++eE++l++++++ lG++ W+ Ia +++ gRt++++k+ w+
  Sevir.5G033000.1.p  67 RGAFSQEEEDLIIELHAVLGNR-WSQIATRLP-GRTDNEIKNLWN 109
                         89********************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.396961IPR017930Myb domain
SuperFamilySSF466891.8E-2912108IPR009057Homeodomain-like
SMARTSM007176.5E-121363IPR001005SANT/Myb domain
PfamPF002495.4E-151461IPR001005SANT/Myb domain
CDDcd001679.79E-111761No hitNo description
PROSITE profilePS5129425.16762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-2565116IPR009057Homeodomain-like
SMARTSM007172.5E-1366114IPR001005SANT/Myb domain
PfamPF002498.7E-1467109IPR001005SANT/Myb domain
CDDcd001679.07E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MGKHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSTV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQEEEDLIIE LHAVLGNRWS QIATRLPGRT DNEIKNLWNS SIKKKLRQKG  120
IDPNTHKPLA EVDRKIAPTI STERTSESSD IDPSSGGALG NLSHLLSETA QSPELLPVLG  180
KHRKETTSLA HLRVPSKELF LDQLVSGNDN LPSCRSTGPI PNFPFQQLMC YSNEFGGKHG  240
GSTNPLWFNQ NESSCSTIST VMPPVSPSTL STSTGLNRSP DNPHSGGTGI QSNQFYWDTT  300
NPSSSSNKGS SGSNSLGFEL QSTSSILENS IFPWTDLSPD KNSHLEEELK WPDLLHGTFT  360
DTPATIQNLS QSLYEDVVKA ENQFNMEGLC AAWSQNLQPQ QHLQVASDLY DKDLQRMSLS  420
FENI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269010.0KJ726901.1 Zea mays clone pUT3446 MYB transcription factor (MYB128) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967646.10.0PREDICTED: transcription factor MYB86
TrEMBLK3XI430.0K3XI43_SETIT; Uncharacterized protein
STRINGSi001565m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-89myb domain protein 61